PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c10_10240V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 1079aa    MW: 116025 Da    PI: 7.256
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c10_10240V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-1554100148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEde l +av+ + g++Wk+Ia+ +   Rt+ qc +rwqk+l
  Pp3c10_10240V3.4.p  54 KGGWTPEEDETLRRAVQCFNGKNWKKIAEFFT-DRTDVQCLHRWQKVL 100
                         688****************************9.************986 PP

2Myb_DNA-binding58.51.5e-18106152148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd+++ ++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
  Pp3c10_10240V3.4.p 106 KGAWTKEEDDRIMELVNKYGAKKWSVIAQNLP-GRIGKQCRERWHNHL 152
                         79******************************.*************97 PP

3Myb_DNA-binding59.47.9e-19158202147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT++Ed+ l++a++++G++ W+ Ia++++ gRt++++k++w++ 
  Pp3c10_10240V3.4.p 158 REAWTQQEDLALIRAHQLYGNK-WAEIAKYLP-GRTDNSIKNHWNST 202
                         789*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.42849100IPR017930Myb domain
SMARTSM007173.5E-1353102IPR001005SANT/Myb domain
PfamPF002497.4E-1454100IPR001005SANT/Myb domain
SuperFamilySSF466891.44E-1555110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2256112IPR009057Homeodomain-like
CDDcd001674.91E-1257100No hitNo description
PROSITE profilePS5129432.127101156IPR017930Myb domain
SuperFamilySSF466894.31E-32103199IPR009057Homeodomain-like
SMARTSM007174.9E-17105154IPR001005SANT/Myb domain
PfamPF002491.2E-17106152IPR001005SANT/Myb domain
CDDcd001673.45E-15108152No hitNo description
Gene3DG3DSA:1.10.10.602.4E-26113159IPR009057Homeodomain-like
PROSITE profilePS5129424.493157207IPR017930Myb domain
SMARTSM007171.1E-18157205IPR001005SANT/Myb domain
PfamPF002492.8E-17158201IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-24160207IPR009057Homeodomain-like
CDDcd001676.23E-14160200No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1079 aa     Download sequence    Send to blast
MASLTVKGKS SSSNENMQQR SSACTSAPES DEDTSHHLPP VHGRTGGPTR RSSKGGWTPE  60
EDETLRRAVQ CFNGKNWKKI AEFFTDRTDV QCLHRWQKVL NPDLVKGAWT KEEDDRIMEL  120
VNKYGAKKWS VIAQNLPGRI GKQCRERWHN HLNPSIKREA WTQQEDLALI RAHQLYGNKW  180
AEIAKYLPGR TDNSIKNHWN STMKKKVDPL TANDPISKAL AVYQAQQEQS MNSGAGAGQA  240
DSGSIGGRPG PPMSEATTSS GPSRHNSNAH AVGRTSHYGE QDTKSTGSAP PPPPHFDMYS  300
NRGKDQQRNA SHLQPKKEES QNDPNGQTQG FSGWSSGQAP MYSGGFSRVP PVGSSSQSNS  360
ITNQLVTSMQ NKRSLSNAEL TRIPSFSNSF SLNPAPESGS HSYMSSAMPV PLPNLGSFFA  420
SSHMSMEPLS NMQPMTSFSG RMVSSGGETL AMTGSMPSYE QLSRCNLPLS QATEADTAVE  480
DSGASVPCES QHEEPMGQAL EQAMDQELSE FSSDDLLRAA SEAVDEFQLQ SPMVTEEDLE  540
DKSKVLERSD GLFYEPPRIA DSPFMSYDLV SSLQAYSPLG VRHMIMPAGN CITPPNYLQS  600
PFQGKSPQSK LRSAARSFSG SPSILRKRPR QILIPLKTGT SGEKLDAKFK EAQTTADNVD  660
AAGACGNNLK TAEASQGTLV GKSSKPAGLH QTCLARTALF VSPASKLSNR VDSEVTRNTG  720
NQSQDCTTGS NGGGEGCGAT FSARVSREGS VSGNALRENA GGKFNKRGRS HGSNLEYSTG  780
SRWENGAQTS KQEGSVLTEQ QQNGQNGQGH PNSSENHGGA MVLGKHGRGE LRQSCDTSAV  840
GSGDSVGGSI SVKVSNKWEL MSPGNAATLS SWGSVTCAMA ACFSPGVTIL QHTPGKDWLQ  900
DFDTTNIFAS PRFPSPRFAS PLWRSPWRLD PLPSAQKEGA LAFMDGLEVP PEDGVDDALG  960
LMRQSNEHNT PAYSEAEEVL AKQPPVQPMP SPLYRLRTSS SRKGHSMKEN RRSLVESDGT  1020
ASALVSWLLP SPEHGITGTP VRGASALGLN VGGEDTLMVG GGGCEQFSPS MYLLKECR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-69542076159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-69542076159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1624630LRKRPRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769995.10.0predicted protein, partial
TrEMBLA9SUL60.0A9SUL6_PHYPA; Predicted protein (Fragment)
STRINGPP1S120_159V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-88myb domain protein 3r-4